Project name: 2zjd bound default 2 runA GGDDDWTHLS ss: CCCCCCEECC

Status: done

submitted: 2015-02-23 11:18:45, status changed: 2015-03-13 11:05:30

Project settings
Protein sequence(s) PSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMK input pdb
Peptide sequence GGDDDWTHLS
Simulation mc cycles50
Peptide secondary structure CCCCCCEECC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 55.8741 2.14769 6.76929 120
cluster_2.pdb ( medoid) 44.867 3.72211 10.0808 167
cluster_3.pdb ( medoid) 24.0468 3.16051 21.0411 76
cluster_4.pdb ( medoid) 21.7222 8.97701 30.6106 195
cluster_5.pdb ( medoid) 18.4495 7.42568 27.8184 137
cluster_6.pdb ( medoid) 16.4444 3.46623 23.9261 57
cluster_7.pdb ( medoid) 12.8453 7.31784 21.5065 94
cluster_8.pdb ( medoid) 9.90644 7.46989 15.1932 74
cluster_9.pdb ( medoid) 3.35007 14.3281 31.9838 48
cluster_10.pdb ( medoid) 3.15231 10.1513 24.3358 32
Laboratory of Theory of Biopolymers 2015