Project name: 746f87b7867e752

Status: done

submitted: 2018-10-09 06:52:32, status changed: 2018-10-09 14:00:04

Project settings
Protein sequence(s) PTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQLRLREGSFRVTRMRCWRVTSSVPVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKS input pdb
Peptide sequence GPLGSPADTCIYNPLFGSD
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCEECCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 42.0044 3.66628 30.7876 154
cluster_2.pdb ( medoid) 20.3487 9.33722 28.7825 190
cluster_3.pdb ( medoid) 15.3959 9.87274 40.971 152
cluster_4.pdb ( medoid) 12.4534 7.06634 32.1605 88
cluster_5.pdb ( medoid) 10.5877 10.0117 33.7079 106
cluster_6.pdb ( medoid) 8.08657 12.2425 47.3437 99
cluster_7.pdb ( medoid) 6.5277 11.0299 24.8182 72
cluster_8.pdb ( medoid) 5.46485 10.9793 33.0632 60
cluster_9.pdb ( medoid) 4.51748 9.29722 23.2037 42
cluster_10.pdb ( medoid) 2.21368 16.7142 44.4403 37

 
Laboratory of Theory of Biopolymers 2015