Project name: 77a901065b877c7

Status: done

submitted: 2017-12-04 18:47:58, status changed: 2017-12-04 20:39:55

Project settings
Protein sequence(s) LIVTQTMMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLLRVYVEEELKPTPEGDLEILLQKWENGECAQKKIIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMMENSAEPEQSLACQCLVRTPEVDDEALEKFDKKALKALPMHIRLSSFNPTQLEEQCHI input pdb
Peptide sequence EEVD
Simulation mc cycles50
Peptide secondary structure psipred CCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 85.0908 2.17415 10.8778 185
cluster_2.pdb ( medoid) 77.7968 2.01808 6.28107 157
cluster_3.pdb ( medoid) 23.0335 5.90446 20.9303 136
cluster_4.pdb ( medoid) 21.5942 6.02013 25.9245 130
cluster_5.pdb ( medoid) 14.4225 8.11231 33.7969 117
cluster_6.pdb ( medoid) 10.724 3.45021 9.87624 37
cluster_7.pdb ( medoid) 9.52799 4.72293 19.401 45
cluster_8.pdb ( medoid) 9.11511 9.32517 23.6774 85
cluster_9.pdb ( medoid) 7.65065 9.80309 29.7106 75
cluster_10.pdb ( medoid) 3.81954 8.63978 22.3164 33

 
Laboratory of Theory of Biopolymers 2015