Project name: 3bfq bound default G ADSTITIRGYVRDNR ss: CCEEEEEEEEEECCC

Status: done

submitted: 2015-02-19 18:28:33, status changed: 2015-03-13 11:07:28

Project settings
Protein sequence(s) AKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS input pdb
Peptide sequence ADSTITIRGYVRDNR
Simulation mc cycles50
Peptide secondary structure CCEEEEEEEEEECCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 44.7123 2.30362 24.0813 103
cluster_2.pdb ( medoid) 32.3135 6.80829 42.3726 220
cluster_3.pdb ( medoid) 15.8034 9.17522 39.0575 145
cluster_4.pdb ( medoid) 11.5168 11.1142 29.8049 128
cluster_5.pdb ( medoid) 10.6161 8.57185 32.8868 91
cluster_6.pdb ( medoid) 7.57067 12.8126 26.2384 97
cluster_7.pdb ( medoid) 6.13951 10.5872 23.0714 65
cluster_8.pdb ( medoid) 5.1417 11.0858 29.2205 57
cluster_9.pdb ( medoid) 3.71056 15.9006 31.3922 59
cluster_10.pdb ( medoid) 2.88096 12.1487 29.2047 35
Laboratory of Theory of Biopolymers 2015