Project name: 7adedc11de3dcb8

Status: done

submitted: 2018-10-09 06:54:02, status changed: 2018-10-09 11:10:25

Project settings
Protein sequence(s) PDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVVLKTAQDEACCLVILAAESKVAAEELCCLLGQVFQVVY input pdb
Peptide sequence VDKVVINPYFGLG
Simulation mc cycles50
Peptide secondary structure psipred CCEEEECCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.7844 2.8647 8.89434 71
cluster_2.pdb ( medoid) 24.1815 4.8384 34.1674 117
cluster_3.pdb ( medoid) 20.635 6.34843 22.5249 131
cluster_4.pdb ( medoid) 14.4676 8.91645 32.1823 129
cluster_5.pdb ( medoid) 13.3417 9.14425 30.9621 122
cluster_6.pdb ( medoid) 13.0112 11.836 41.7228 154
cluster_7.pdb ( medoid) 8.99881 5.88967 18.332 53
cluster_8.pdb ( medoid) 8.97468 9.13682 25.0158 82
cluster_9.pdb ( medoid) 6.7622 15.0839 33.1663 102
cluster_10.pdb ( medoid) 2.83102 13.7759 39.6801 39

 
Laboratory of Theory of Biopolymers 2015