Project name: GRPR_Neuromedin

Status: done

submitted: 2017-12-05 10:24:39, status changed: 2017-12-05 14:46:57

Project settings
Protein sequence(s) ILYVIPAVYGVIILIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSDLHPFHEESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQSAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLC input pdb
Peptide sequence GNHWAVGHLM
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEEECC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 32.2384 6.29684 26.4541 203
cluster_2.pdb ( medoid) 25.5371 4.81652 13.9995 123
cluster_3.pdb ( medoid) 23.609 5.50637 11.2935 130
cluster_4.pdb ( medoid) 23.044 5.20742 11.3463 120
cluster_5.pdb ( medoid) 22.2056 4.23316 19.5645 94
cluster_6.pdb ( medoid) 15.7927 4.93898 10.5898 78
cluster_7.pdb ( medoid) 15.4282 5.83347 15.9167 90
cluster_8.pdb ( medoid) 8.32024 8.17285 18.2174 68
cluster_9.pdb ( medoid) 8.0386 7.33958 17.5085 59
cluster_10.pdb ( medoid) 2.41806 14.4744 29.3 35

 
Laboratory of Theory of Biopolymers 2015