Project name: 2AM9 unbound default 2 run A SSRFESLFAG ss: CHHHHHHHHC

Status: done

submitted: 2015-02-25 18:46:51, status changed: 2015-03-30 08:47:59

Project settings
Protein sequence(s) QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ input pdb
Peptide sequence SSRFESLFAG
Simulation mc cycles50
Peptide secondary structure CHHHHHHHHC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 37.4285 5.18322 32.1815 194
cluster_2.pdb ( medoid) 27.9318 2.57771 10.9276 72
cluster_3.pdb ( medoid) 27.7028 4.58438 28.5747 127
cluster_4.pdb ( medoid) 22.6242 6.09967 28.836 138
cluster_5.pdb ( medoid) 12.9826 10.7066 32.9711 139
cluster_6.pdb ( medoid) 12.9366 3.4785 10.4037 45
cluster_7.pdb ( medoid) 9.56004 9.20498 25.6823 88
cluster_8.pdb ( medoid) 7.38359 15.4396 36.5743 114
cluster_9.pdb ( medoid) 4.02117 17.9053 41.2641 72
cluster_10.pdb ( medoid) 1.05461 10.4304 22.3442 11
Laboratory of Theory of Biopolymers 2015