Project name: MYCMYB_SM4RQW

Status: done

submitted: 2018-07-11 15:32:54, status changed: 2018-07-26 00:12:30

Project settings
Protein sequence(s) DNLQQRLQALIEGANENWTYAVFWQSSHGFAGEDNNNNNTVLLGWGDGYYKGEEEKSRKKKSNPASAAEQEHRKRVIRELNSLISGGVGGGDEAGDEEVTDTEWFFLVSMTQSFVKGTGLPGQAFSNSDTIWLSGSNALAGSSCERARQGQIYGLQTMVCVATENGVVELGSSEIIHQSSDLVDKVDTFFN input pdb
Peptide sequence FKRSSSTSKLLNKVAARASSMG
Simulation mc cycles200
Peptide secondary structure psipred CCCCHHHHHHHHHHHHHHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 22.2478 6.47256 33.3698 144
cluster_2.pdb ( medoid) 20.0421 7.9333 35.6931 159
cluster_3.pdb ( medoid) 19.1063 6.75168 21.4133 129
cluster_4.pdb ( medoid) 14.0479 7.33204 31.9374 103
cluster_5.pdb ( medoid) 11.5297 7.02532 19.0976 81
cluster_6.pdb ( medoid) 10.5815 12.8527 47.1777 136
cluster_7.pdb ( medoid) 8.47141 10.2698 30.5926 87
cluster_8.pdb ( medoid) 5.15135 12.8122 39.468 66
cluster_9.pdb ( medoid) 4.79621 14.5949 52.8758 70
cluster_10.pdb ( medoid) 1.26192 19.8111 38.1051 25

 
Laboratory of Theory of Biopolymers 2015