Project name: cattle_FFAWG

Status: done

submitted: 2018-07-09 00:39:44, status changed: 2018-07-24 05:18:25

Project settings
Protein sequence(s) MTSLPGMTLDPSAPPPLLLDSSYVSPDYGNLSLLSSLPAANISSNKLYQVPVGFIVLLSIFYGIISLVAVAGNFMVMWIVATSRRMQTVTNFFIANLAVADIIIGLFSIPFQFQAALLQRWVLPEFMCAFCPFVQVLSVNVSIFTLTAIALDRYRAVMSPLKARTTKLRAKFIICGIWTLAVAAALPCALALRVETQVESHALNLTKPFCHEVGISRKAWRIYNHVLVCLQYFFPLLTICFVYARMGLKLKESKSPGNAQGARDAGILKNKKKVIKMLFVIVALFAFCWLPYQLYNILREVFPKIDKYKYINIIWFCTHWLAMSNSCYNPFIYAIYNERFKREFATRCTCGGHRYKSPKSRFASYEQEDNSTIIVSMRHSFRLSFKNSAPLKASTQV input pdb
Peptide sequence FFAWG
Simulation mc cycles50
Peptide secondary structure psipred CCCCC
Unlikely to bind regions
232:A - 288:A 142:A - 184:A 106:A - 63:A 330:A - 397:A
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 83.0891 1.29981 27.4048 108
cluster_2.pdb ( medoid) 33.2798 3.60579 7.05894 120
cluster_3.pdb ( medoid) 28.2788 8.13332 35.9476 230
cluster_4.pdb ( medoid) 21.8922 3.19749 33.5801 70
cluster_5.pdb ( medoid) 21.2358 4.56775 41.5809 97
cluster_6.pdb ( medoid) 19.0211 2.62866 7.34231 50
cluster_7.pdb ( medoid) 8.80502 7.6093 32.8519 67
cluster_8.pdb ( medoid) 1.85607 15.6244 30.0561 29
cluster_9.pdb ( medoid) 1.15192 26.0434 60.6576 30
cluster_10.pdb ( medoid) 0.931766 15.0252 31.0003 14

 
Laboratory of Theory of Biopolymers 2015