Project name: 2foj bound default 2 runA GARAHSS ss: CCCCECC

Status: done

submitted: 2015-02-23 11:18:39, status changed: 2015-03-13 11:10:18

Project settings
Protein sequence(s) TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW input pdb
Peptide sequence GARAHSS
Simulation mc cycles50
Peptide secondary structure CCCCECC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 48.9626 1.32754 7.78876 65
cluster_2.pdb ( medoid) 20.2195 7.9626 35.4009 161
cluster_3.pdb ( medoid) 20.1494 11.0177 37.6912 222
cluster_4.pdb ( medoid) 18.6452 4.82697 19.4491 90
cluster_5.pdb ( medoid) 17.1695 4.30997 13.3007 74
cluster_6.pdb ( medoid) 15.2003 10.1972 32.9688 155
cluster_7.pdb ( medoid) 5.22444 16.6525 34.1035 87
cluster_8.pdb ( medoid) 3.68715 16.0015 38.9596 59
cluster_9.pdb ( medoid) 3.62247 12.9746 36.5765 47
cluster_10.pdb ( medoid) 2.61621 15.2893 39.9011 40
Laboratory of Theory of Biopolymers 2015