Project name: 1N83 unbound default A HKILHRLLQE ss: CHHHHHHHHC

Status: done

submitted: 2015-02-20 17:44:36, status changed: 2015-03-13 11:11:51

Project settings
Protein sequence(s) HHLEVLFQGPAELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELF input pdb
Peptide sequence HKILHRLLQE
Simulation mc cycles50
Peptide secondary structure CHHHHHHHHC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 45.0289 4.9968 26.1481 225
cluster_2.pdb ( medoid) 39.6764 2.14233 11.5229 85
cluster_3.pdb ( medoid) 27.0844 4.50444 12.7289 122
cluster_4.pdb ( medoid) 19.9127 3.76644 21.0643 75
cluster_5.pdb ( medoid) 13.4918 9.85782 31.959 133
cluster_6.pdb ( medoid) 10.8206 5.45255 21.5072 59
cluster_7.pdb ( medoid) 10.7715 9.00527 25.3408 97
cluster_8.pdb ( medoid) 10.5553 5.40014 22.6359 57
cluster_9.pdb ( medoid) 5.88767 13.248 38.5113 78
cluster_10.pdb ( medoid) 4.31395 15.9946 36.7273 69
Laboratory of Theory of Biopolymers 2015