Project name: 2p1k bound default 3 runA SATSAKATQTD ss: CCEEEEEEECC

Status: done

submitted: 2015-02-23 11:19:17, status changed: 2015-03-13 11:12:31

Project settings
Protein sequence(s) DRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG input pdb
Peptide sequence SATSAKATQTD
Simulation mc cycles50
Peptide secondary structure CCEEEEEEECC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.588 4.83296 29.4776 114
cluster_2.pdb ( medoid) 21.8061 5.59476 24.4875 122
cluster_3.pdb ( medoid) 18.7591 7.08988 33.2384 133
cluster_4.pdb ( medoid) 17.4817 6.4639 30.7651 113
cluster_5.pdb ( medoid) 11.3236 9.97912 31.2125 113
cluster_6.pdb ( medoid) 10.0506 4.27836 12.1447 43
cluster_7.pdb ( medoid) 9.06994 12.3485 32.8772 112
cluster_8.pdb ( medoid) 8.34569 7.78845 24.7588 65
cluster_9.pdb ( medoid) 7.37427 16.4084 34.174 121
cluster_10.pdb ( medoid) 4.56914 14.007 30.7591 64
Laboratory of Theory of Biopolymers 2015