Project name: 1cka bound default 3 runA PPPALPPKK ss: CCCCCCCCC

Status: done

submitted: 2015-02-23 11:18:57, status changed: 2015-03-13 11:14:43

Project settings
Protein sequence(s) AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKY input pdb
Peptide sequence PPPALPPKK
Simulation mc cycles50
Peptide secondary structure CCCCCCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.5053 5.01198 20.2382 198
cluster_2.pdb ( medoid) 23.2947 5.40895 23.7485 126
cluster_3.pdb ( medoid) 20.54 8.17914 24.716 168
cluster_4.pdb ( medoid) 19.3441 5.27292 12.1246 102
cluster_5.pdb ( medoid) 17.5356 4.39107 14.02 77
cluster_6.pdb ( medoid) 12.316 8.68786 25.4067 107
cluster_7.pdb ( medoid) 7.99084 11.5132 29.6587 92
cluster_8.pdb ( medoid) 6.11158 8.01756 17.035 49
cluster_9.pdb ( medoid) 4.33087 9.00511 21.3268 39
cluster_10.pdb ( medoid) 4.26629 9.84463 24.2538 42
Laboratory of Theory of Biopolymers 2015