Project name: 1i8k bound default AB KKGNYVVTDH ss: CECCECCCCC

Status: done

submitted: 2015-02-19 18:28:13, status changed: 2015-03-13 11:15:48

Project settings
Protein sequence(s) DIELTQSPASLSVATGEKVTIRCMTSTDIDDDMNWYQQKPGEPPKFLISEGNTLRPGVPSRFSSSGTGTDFVFTIENTLSEDVGDYYCLQSFNVPLTFGCGTKLEIQVKLQQSGGGLVKPGASLKLSCVTSGFTFRKFGMSWVRQTSDKCLEWVASISTGGYNTYYSDNVKGRFTISRENAKNTLYLQMSSLKSEDTALYYCTRGYSSTSYAMDYWGQGTTVTVS input pdb
Peptide sequence KKGNYVVTDH
Simulation mc cycles50
Peptide secondary structure CECCECCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 52.9263 1.66269 3.55728 88
cluster_2.pdb ( medoid) 33.6872 4.66052 37.2623 157
cluster_3.pdb ( medoid) 29.6492 7.11655 22.9885 211
cluster_4.pdb ( medoid) 23.0411 7.81214 37.777 180
cluster_5.pdb ( medoid) 19.055 3.77854 20.8077 72
cluster_6.pdb ( medoid) 16.0189 3.5583 23.5795 57
cluster_7.pdb ( medoid) 10.3366 13.3506 51.2622 138
cluster_8.pdb ( medoid) 3.77319 10.6011 28.6406 40
cluster_9.pdb ( medoid) 2.43768 13.9477 37.3383 34
cluster_10.pdb ( medoid) 1.87124 12.2913 29.9435 23
Laboratory of Theory of Biopolymers 2015