Project name: a7fc592737ae75d

Status: done

submitted: 2017-09-14 05:01:24, status changed: 2017-09-14 06:23:37

Project settings
Protein sequence(s) TYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTAVNIQPPPVNRNLKPDR input pdb
Peptide sequence EGKVVQP
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.6064 3.46077 16.8752 99
cluster_2.pdb ( medoid) 24.4928 5.43016 27.9511 133
cluster_3.pdb ( medoid) 19.4719 4.51932 13.3469 88
cluster_4.pdb ( medoid) 18.7903 7.18457 22.4865 135
cluster_5.pdb ( medoid) 17.7818 6.8047 26.0502 121
cluster_6.pdb ( medoid) 13.366 12.0455 29.1802 161
cluster_7.pdb ( medoid) 8.29171 12.9044 28.5976 107
cluster_8.pdb ( medoid) 7.45939 6.03266 17.7878 45
cluster_9.pdb ( medoid) 5.78917 13.3007 29.6334 77
cluster_10.pdb ( medoid) 3.10578 10.9473 21.0332 34

 
Laboratory of Theory of Biopolymers 2015