Project name: a917e6f8cd13e32

Status: done

submitted: 2018-01-10 10:41:56, status changed: 2018-01-10 15:41:59

Project settings
Protein sequence(s) KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCDDPSQPQTTKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLRHRKV input pdb
Peptide sequence MARTKQTARKSTGGKAPRKQLA
Simulation mc cycles50
Peptide secondary structure psipred CHHHHHHHHHHCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.7818 7.1756 37.9602 185
cluster_2.pdb ( medoid) 22.9666 8.96955 35.3565 206
cluster_3.pdb ( medoid) 17.0557 7.79799 28.6962 133
cluster_4.pdb ( medoid) 15.5311 12.5555 41.5033 195
cluster_5.pdb ( medoid) 7.39359 5.00433 11.2481 37
cluster_6.pdb ( medoid) 6.80312 5.1447 19.496 35
cluster_7.pdb ( medoid) 4.6782 8.33655 26.903 39
cluster_8.pdb ( medoid) 4.24945 16.4727 35.7853 70
cluster_9.pdb ( medoid) 2.91551 19.2076 42.1203 56
cluster_10.pdb ( medoid) 2.30499 19.089 40.1842 44

 
Laboratory of Theory of Biopolymers 2015