Project name: 1I7G unbound default 2 run A ARHKILHRLLQE ss: CCCHHHHHHHHC

Status: done

submitted: 2015-02-25 18:46:57, status changed: 2015-03-13 11:16:32

Project settings
Protein sequence(s) ETADLKSLAKRIYEAYLKNFNMNKVKARVILSGSNNPPFVIHDMETLCMAEKTLQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY input pdb
Peptide sequence ARHKILHRLLQE
Simulation mc cycles50
Peptide secondary structure CCCHHHHHHHHC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 35.5874 3.48438 10.8658 124
cluster_2.pdb ( medoid) 24.0393 3.66067 7.45602 88
cluster_3.pdb ( medoid) 23.2561 7.8259 25.5104 182
cluster_4.pdb ( medoid) 20.1711 8.27919 19.8877 167
cluster_5.pdb ( medoid) 19.7777 8.79779 34.431 174
cluster_6.pdb ( medoid) 17.9219 5.30076 13.6517 95
cluster_7.pdb ( medoid) 16.4999 4.24245 7.3985 70
cluster_8.pdb ( medoid) 5.4763 7.85202 19.4808 43
cluster_9.pdb ( medoid) 4.80128 9.99734 25.2382 48
cluster_10.pdb ( medoid) 0.836569 10.7582 18.407 9
Laboratory of Theory of Biopolymers 2015