Project name: ab5cfbf5e50f94a

Status: done

submitted: 2017-09-14 08:56:35, status changed: 2017-09-15 01:12:06

Project settings
Protein sequence(s) MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLIMSADVPLVVEYKIADMGHLKYYLAPKIEDEMFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLIMSADVPLVVEYKIADMGHLKYYLAPKIMFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLIMSADVPLVVEYKIADMGHLKYYLAPKIE input pdb
Peptide sequence PLKFIVKKNP
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEECCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 101.36 0.986583 5.28459 100
cluster_2.pdb ( medoid) 66.1958 3.05155 33.9887 202
cluster_3.pdb ( medoid) 45.2211 2.36615 32.4507 107
cluster_4.pdb ( medoid) 19.4054 11.5947 47.3828 225
cluster_5.pdb ( medoid) 6.60821 13.0141 27.8295 86
cluster_6.pdb ( medoid) 2.42168 14.4528 42.4605 35
cluster_7.pdb ( medoid) 2.40967 20.7497 41.5348 50
cluster_8.pdb ( medoid) 2.02469 18.2744 40.4928 37
cluster_9.pdb ( medoid) 1.98081 18.1744 45.5403 36
cluster_10.pdb ( medoid) 1.6525 15.1286 36.974 25

 
Laboratory of Theory of Biopolymers 2015