Project name: WAY2

Status: done

submitted: 2017-09-13 09:47:26, status changed: 2017-09-13 11:50:40

Project settings
Protein sequence(s) IQRPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQ input pdb
Peptide sequence LSFGSLPGG
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 47.6514 3.67251 9.20152 175
cluster_2.pdb ( medoid) 37.6695 5.6279 27.5673 212
cluster_3.pdb ( medoid) 28.9384 7.04946 33.9083 204
cluster_4.pdb ( medoid) 20.6681 3.77393 12.4969 78
cluster_5.pdb ( medoid) 15.3002 4.31366 10.3437 66
cluster_6.pdb ( medoid) 12.739 4.23894 10.5926 54
cluster_7.pdb ( medoid) 10.7816 5.28679 23.4379 57
cluster_8.pdb ( medoid) 9.27788 8.29931 24.6237 77
cluster_9.pdb ( medoid) 7.33399 3.95419 9.50817 29
cluster_10.pdb ( medoid) 3.50265 13.7039 30.6161 48

 
Laboratory of Theory of Biopolymers 2015