CABS-dock: 9B

Project name: 9B_pep9A

Status: done

submitted: 2018-01-13 21:50:32, status changed: 2018-01-13 23:53:51

Project settings

Protein sequence(s)	PGDSVAHGEIANVPNGMCLDAKEKSEEETSVSIYECHGQGGNQYWMLSKAGEIRRDDSCLDYAGKDVTLFGCHGGKGNQFWTYRENTKQLHHGTSGKCLAISESKDKLLMEECSASLSRQQWTLENYDSSKL input pdb
Peptide sequence	PTTTEPTTTEPTTTE
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	45.4582	2.77178	7.93359	126
cluster_2.pdb ( medoid)	23.2482	4.73155	28.6477	110
cluster_3.pdb ( medoid)	21.1084	5.25857	25.892	111
cluster_4.pdb ( medoid)	20.6026	6.64963	24.4763	137
cluster_5.pdb ( medoid)	11.938	10.4708	23.4066	125
cluster_6.pdb ( medoid)	9.33893	11.5645	34.0052	108
cluster_7.pdb ( medoid)	8.54597	10.6483	27.9382	91
cluster_8.pdb ( medoid)	6.88524	10.6024	30.0922	73
cluster_9.pdb ( medoid)	6.37206	8.4745	29.2461	54
cluster_10.pdb ( medoid)	6.10711	10.6433	24.799	65