Project name: 2DS7 unbound default 2 run A ALRVVK ss: CCEECC

Status: done

submitted: 2015-02-25 18:46:54, status changed: 2015-03-13 11:17:45

Project settings
Protein sequence(s) LYCSFCGKSQHEVRKLIAGPSVYICDECVDLMNDIIREEI input pdb
Peptide sequence ALRVVK
Simulation mc cycles50
Peptide secondary structure CCEECC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 43.9884 3.20539 8.88839 141
cluster_2.pdb ( medoid) 35.5878 3.96203 13.7787 141
cluster_3.pdb ( medoid) 28.6998 5.64464 17.3091 162
cluster_4.pdb ( medoid) 28.0496 3.24426 15.6519 91
cluster_5.pdb ( medoid) 19.549 5.26881 12.9026 103
cluster_6.pdb ( medoid) 13.07 8.64574 29.4071 113
cluster_7.pdb ( medoid) 12.2417 6.12661 20.6175 75
cluster_8.pdb ( medoid) 8.93721 7.27297 19.4965 65
cluster_9.pdb ( medoid) 7.2384 8.56543 22.6814 62
cluster_10.pdb ( medoid) 4.00535 11.7343 25.065 47
Laboratory of Theory of Biopolymers 2015