Project name: ba4487e892f0924

Status: done

submitted: 2017-09-13 10:31:17, status changed: 2017-09-13 11:32:49

Project settings
Protein sequence(s) NDIARGFERGLEPEKIIGATDDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEEE input pdb
Peptide sequence PKVFM
Simulation mc cycles50
Peptide secondary structure psipred CCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 63.0679 2.18812 14.9477 138
cluster_2.pdb ( medoid) 53.5283 2.46598 5.48033 132
cluster_3.pdb ( medoid) 30.7657 6.01319 26.3303 185
cluster_4.pdb ( medoid) 23.0661 4.07525 10.0506 94
cluster_5.pdb ( medoid) 21.946 5.65022 22.9235 124
cluster_6.pdb ( medoid) 12.0299 8.47889 30.5567 102
cluster_7.pdb ( medoid) 4.96394 13.9002 30.8427 69
cluster_8.pdb ( medoid) 4.83196 14.6938 37.9049 71
cluster_9.pdb ( medoid) 3.8043 10.5144 22.6054 40
cluster_10.pdb ( medoid) 2.92146 15.4033 31.8441 45

 
Laboratory of Theory of Biopolymers 2015