Project name: 2fnt bound default AB RQVNFLG ss: CEECCEC

Status: done

submitted: 2015-02-19 18:28:26, status changed: 2015-03-13 11:19:17

Project settings
Protein sequence(s) PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNFPQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF input pdb
Peptide sequence RQVNFLG
Simulation mc cycles50
Peptide secondary structure CEECCEC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 87.0011 1.51722 24.9238 132
cluster_2.pdb ( medoid) 37.7319 5.83061 29.564 220
cluster_3.pdb ( medoid) 37.7119 1.21977 17.6198 46
cluster_4.pdb ( medoid) 29.1974 0.89049 1.79014 26
cluster_5.pdb ( medoid) 19.5627 6.95202 32.5514 136
cluster_6.pdb ( medoid) 12.6827 10.2502 36.0365 130
cluster_7.pdb ( medoid) 11.8881 10.767 33.5515 128
cluster_8.pdb ( medoid) 8.66184 12.0067 39.7223 104
cluster_9.pdb ( medoid) 4.06621 11.3127 35.0523 46
cluster_10.pdb ( medoid) 2.10322 15.2148 38.5791 32
Laboratory of Theory of Biopolymers 2015