Project name: 2h9m bound default 3 runC ARTKQ ss: CCCCC

Status: done

submitted: 2015-02-23 11:19:14, status changed: 2015-03-13 11:19:51

Project settings
Protein sequence(s) VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC input pdb
Peptide sequence ARTKQ
Simulation mc cycles50
Peptide secondary structure CCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 766.524 0.116109 3.65199 89
cluster_2.pdb ( medoid) 46.1136 6.59241 36.5531 304
cluster_3.pdb ( medoid) 30.607 4.90085 27.1929 150
cluster_4.pdb ( medoid) 20.5254 5.35921 34.3574 110
cluster_5.pdb ( medoid) 16.8845 5.15265 28.1736 87
cluster_6.pdb ( medoid) 15.1779 6.32501 19.6169 96
cluster_7.pdb ( medoid) 7.38947 8.39032 28.9079 62
cluster_8.pdb ( medoid) 6.63018 9.95448 35.0011 66
cluster_9.pdb ( medoid) 2.16212 10.6377 23.3506 23
cluster_10.pdb ( medoid) 0.89754 14.484 31.6077 13
Laboratory of Theory of Biopolymers 2015