Project name: 2iv9 bound default AB SFGDGFADF ss: CCCCHHHHC

Status: done

submitted: 2015-02-19 18:28:28, status changed: 2015-03-13 11:20:59

Project settings
Protein sequence(s) MAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKNGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN input pdb
Peptide sequence SFGDGFADF
Simulation mc cycles50
Peptide secondary structure CCCCHHHHC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.436 1.49609 7.28103 59
cluster_2.pdb ( medoid) 32.0478 1.31054 4.30868 42
cluster_3.pdb ( medoid) 28.7576 5.52896 22.9832 159
cluster_4.pdb ( medoid) 24.4973 4.2862 26.5231 105
cluster_5.pdb ( medoid) 21.645 9.4248 33.6405 204
cluster_6.pdb ( medoid) 19.662 6.6626 25.7844 131
cluster_7.pdb ( medoid) 7.67431 10.5547 41.6116 81
cluster_8.pdb ( medoid) 3.16178 14.5488 47.232 46
cluster_9.pdb ( medoid) 2.58443 16.2511 45.1873 42
cluster_10.pdb ( medoid) 2.54585 12.1767 48.2798 31
Laboratory of Theory of Biopolymers 2015