Project name: 2fnt bound default 3 runAB RQVNFLG ss: CEECCEC

Status: done

submitted: 2015-02-23 11:19:14, status changed: 2015-03-13 11:22:13

Project settings
Protein sequence(s) PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNFPQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF input pdb
Peptide sequence RQVNFLG
Simulation mc cycles50
Peptide secondary structure CEECCEC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 49.4248 2.73142 13.7973 135
cluster_2.pdb ( medoid) 27.3222 3.03782 23.869 83
cluster_3.pdb ( medoid) 20.4813 10.8392 47.997 222
cluster_4.pdb ( medoid) 17.3885 7.13114 32.022 124
cluster_5.pdb ( medoid) 14.1519 7.49014 35.0172 106
cluster_6.pdb ( medoid) 9.21041 16.0688 38.5977 148
cluster_7.pdb ( medoid) 7.28547 10.569 25.3405 77
cluster_8.pdb ( medoid) 5.24776 11.2429 39.5082 59
cluster_9.pdb ( medoid) 4.11081 5.10848 22.8972 21
cluster_10.pdb ( medoid) 1.54847 16.145 33.9292 25
Laboratory of Theory of Biopolymers 2015