Project name: MYCMYB_PH2

Status: done

submitted: 2018-07-11 15:32:46, status changed: 2018-07-26 08:30:03

Project settings
Protein sequence(s) LPQVNEDNLQQRLQALIEGANENWTYAVFWQSSHGFAGEDNNNNNTVLLGWGDGYYKGEEEKSRKKKSNPASAAEQEHRKRVIRELNSLISGGVGGGDEAGDEEVTDTEWFFLVSMTQSFVKGTGLPGQAFSNSDTIWLSGSNALAGSSCERARQGQIYGLQTMVCVATENGVVELGSSEIIHQSSDLVDKVDTFFNFN input pdb
Peptide sequence FKRSSSTSKLLNKVAARASSMG
Simulation mc cycles200
Peptide secondary structure psipred CCCCHHHHHHHHHHHHHHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.9811 4.61571 20.4459 143
cluster_2.pdb ( medoid) 23.1739 7.12009 21.7499 165
cluster_3.pdb ( medoid) 17.8855 6.42979 18.0397 115
cluster_4.pdb ( medoid) 16.6801 4.97597 17.7088 83
cluster_5.pdb ( medoid) 15.7143 5.47271 18.4857 86
cluster_6.pdb ( medoid) 13.9472 7.3133 24.2723 102
cluster_7.pdb ( medoid) 12.7408 10.6744 33.1014 136
cluster_8.pdb ( medoid) 10.8264 7.38936 17.5203 80
cluster_9.pdb ( medoid) 6.77472 10.1849 21.1394 69
cluster_10.pdb ( medoid) 1.55808 13.4781 30.9767 21

 
Laboratory of Theory of Biopolymers 2015