Project name: d36ac7c0503cbf2

Status: done

submitted: 2017-12-05 12:12:17, status changed: 2017-12-05 14:52:35

Project settings
Protein sequence(s) PLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLAR input pdb
Peptide sequence WCWNCGCEWNRVCMGDHWFDV
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCCCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 51.034 2.01826 23.8185 103
cluster_2.pdb ( medoid) 18.5679 4.30851 19.7259 80
cluster_3.pdb ( medoid) 14.3157 12.9229 29.0158 185
cluster_4.pdb ( medoid) 11.246 10.4927 32.1309 118
cluster_5.pdb ( medoid) 10.9103 12.3737 24.9073 135
cluster_6.pdb ( medoid) 7.71946 9.58616 20.8781 74
cluster_7.pdb ( medoid) 7.62315 11.9373 24.6834 91
cluster_8.pdb ( medoid) 7.34724 10.2079 28.3417 75
cluster_9.pdb ( medoid) 7.14084 6.7219 18.8705 48
cluster_10.pdb ( medoid) 6.24187 14.579 31.2966 91

 
Laboratory of Theory of Biopolymers 2015