Project name: d3d70ecf05bb2d6

Status: done

submitted: 2018-01-02 11:11:51, status changed: 2018-01-02 12:45:45

Project settings
Protein sequence(s) MELKRKTTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAIRYIEGLQALLRD input pdb
Peptide sequence SNPNQRLPKVEILRNAIRYI
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCHHHHHHHHHHHC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 18.245 8.98876 27.9025 164
cluster_2.pdb ( medoid) 14.5052 10.8237 29.5217 157
cluster_3.pdb ( medoid) 12.3033 10.8101 30.6361 133
cluster_4.pdb ( medoid) 10.8055 6.75582 24.9121 73
cluster_5.pdb ( medoid) 10.5239 7.50675 22.6278 79
cluster_6.pdb ( medoid) 9.50894 10.9371 27.5196 104
cluster_7.pdb ( medoid) 7.74202 11.2374 25.5981 87
cluster_8.pdb ( medoid) 6.444 12.4147 27.2432 80
cluster_9.pdb ( medoid) 5.9419 12.6222 25.4131 75
cluster_10.pdb ( medoid) 4.02023 11.9396 26.3143 48

 
Laboratory of Theory of Biopolymers 2015