Project name: 1gyb bound default 3 runB GFSFG ss: CCCCC

Status: done

submitted: 2015-02-23 11:18:59, status changed: 2015-03-13 11:25:00

Project settings
Protein sequence(s) LDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQPASPYGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDGNSYYVFNDIFRLNYS input pdb
Peptide sequence GFSFG
Simulation mc cycles50
Peptide secondary structure CCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 123.226 0.486908 2.21043 60
cluster_2.pdb ( medoid) 75.9569 0.882079 7.59641 67
cluster_3.pdb ( medoid) 45.2511 1.65742 21.0487 75
cluster_4.pdb ( medoid) 34.915 1.94758 14.2955 68
cluster_5.pdb ( medoid) 25.7228 5.5204 19.8664 142
cluster_6.pdb ( medoid) 19.4777 8.36854 23.2817 163
cluster_7.pdb ( medoid) 15.6758 6.31545 17.643 99
cluster_8.pdb ( medoid) 15.6201 7.49035 24.7703 117
cluster_9.pdb ( medoid) 13.9904 10.8646 31.4031 152
cluster_10.pdb ( medoid) 4.80095 11.8727 31.161 57
Laboratory of Theory of Biopolymers 2015