Project name: de5d0ea11b9b899

Status: done

submitted: 2018-01-12 16:12:21, status changed: 2018-01-12 19:52:18

Project settings
Protein sequence(s) GPLGSMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGWIAQELRIGDFNAYYA input pdb
Peptide sequence WIAQELRIGDFNAYYA
Simulation mc cycles50
Peptide secondary structure psipred CCCCEEECCCCCEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 26.0541 4.29874 16.0099 112
cluster_2.pdb ( medoid) 17.3701 8.69308 32.5028 151
cluster_3.pdb ( medoid) 17.1133 7.36268 26.3744 126
cluster_4.pdb ( medoid) 13.3958 8.13689 19.3477 109
cluster_5.pdb ( medoid) 12.9488 5.6376 19.1397 73
cluster_6.pdb ( medoid) 9.33375 15.2136 36.3224 142
cluster_7.pdb ( medoid) 7.40631 12.2868 30.5609 91
cluster_8.pdb ( medoid) 6.58673 8.35013 16.0508 55
cluster_9.pdb ( medoid) 5.34615 10.6619 21.8483 57
cluster_10.pdb ( medoid) 4.70113 17.8681 36.9878 84

 
Laboratory of Theory of Biopolymers 2015