Project name: e516e9d4804e152

Status: done

submitted: 2018-07-06 12:57:42, status changed: 2018-07-21 01:59:31

Project settings
Protein sequence(s) SLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQ input pdb
Peptide sequence NGNIRCTICI
Simulation mc cycles50
Peptide secondary structure psipred CCCEEEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.9784 6.12831 24.1682 245
cluster_2.pdb ( medoid) 18.7659 7.1406 18.8216 134
cluster_3.pdb ( medoid) 9.82487 7.93904 22.1237 78
cluster_4.pdb ( medoid) 9.59206 11.3636 34.0854 109
cluster_5.pdb ( medoid) 8.42366 15.314 37.2245 129
cluster_6.pdb ( medoid) 5.62857 14.9239 31.0234 84
cluster_7.pdb ( medoid) 5.10682 10.9657 24.8836 56
cluster_8.pdb ( medoid) 4.9613 15.5201 35.4525 77
cluster_9.pdb ( medoid) 3.81109 11.0205 30.251 42
cluster_10.pdb ( medoid) 3.7522 12.2595 22.3818 46

 
Laboratory of Theory of Biopolymers 2015