Project name: H18E5OK7Kk 1zt7

Status: done

submitted: 2018-01-10 06:18:22, status changed: 2018-01-11 09:31:19

Project settings
Protein sequence(s) GPHSLRYFHTAVSRPGLGKPRFISVGYVDDTQFVRFDSDAENPRYEPRVRWMEQVEPEYWERNTQIAKGNEQIFRVNLRTALRYYNQSAGGSHTFQRMYGCEVGSDWRLLRGYEQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGDAERDRAYLEGTCVEWLRRYLQLGNATLPRTDSPKAHVTRHSRPEDKVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM input pdb
Peptide sequence MLLLHIHAI
Simulation mc cycles200
Peptide secondary structure psipred CEEEEEEEC
Unlikely to bind regions
1:B - 99:B 177:A - 275:A
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 63.3575 1.95715 27.8625 124
cluster_2.pdb ( medoid) 59.0763 2.52216 29.0225 149
cluster_3.pdb ( medoid) 40.1013 1.47127 4.16507 59
cluster_4.pdb ( medoid) 28.6315 6.00737 32.1819 172
cluster_5.pdb ( medoid) 26.1133 6.66327 46.8348 174
cluster_6.pdb ( medoid) 25.7824 4.88705 13.2758 126
cluster_7.pdb ( medoid) 23.7273 2.8659 11.8539 68
cluster_8.pdb ( medoid) 23.3727 2.82381 7.63278 66
cluster_9.pdb ( medoid) 3.45689 10.9925 26.7934 38
cluster_10.pdb ( medoid) 1.65982 14.4594 35.3919 24

 
Laboratory of Theory of Biopolymers 2015