Project name: ec94bdebd78502e

Status: done

submitted: 2018-07-05 12:38:10, status changed: 2018-07-20 15:11:24

Project settings
Protein sequence(s) GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA input pdb
Peptide sequence VEITPNSPRAEA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 31.4155 3.27864 13.3523 103
cluster_2.pdb ( medoid) 29.1031 4.5356 14.8376 132
cluster_3.pdb ( medoid) 28.2388 7.40116 23.212 209
cluster_4.pdb ( medoid) 14.7192 8.69613 19.8727 128
cluster_5.pdb ( medoid) 14.497 6.55309 14.8168 95
cluster_6.pdb ( medoid) 10.7686 10.3078 24.335 111
cluster_7.pdb ( medoid) 7.19053 11.8211 29.1037 85
cluster_8.pdb ( medoid) 5.21053 5.37374 16.5246 28
cluster_9.pdb ( medoid) 4.91122 11.6061 21.9969 57
cluster_10.pdb ( medoid) 4.50512 11.5424 29.0183 52

 
Laboratory of Theory of Biopolymers 2015