Project name: 1D1Z unbound default 3 run C KSLTIYAQVQK ss: CCCCCCCCCCC

Status: done

submitted: 2015-02-25 18:47:29, status changed: 2015-03-13 11:30:29

Project settings
Protein sequence(s) VAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK input pdb
Peptide sequence KSLTIYAQVQK
Simulation mc cycles50
Peptide secondary structure CCCCCCCCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 36.7084 5.23041 24.9537 192
cluster_2.pdb ( medoid) 29.4575 3.63235 10.1541 107
cluster_3.pdb ( medoid) 24.0469 5.19817 13.7362 125
cluster_4.pdb ( medoid) 21.1184 4.59315 14.2065 97
cluster_5.pdb ( medoid) 19.4794 5.0823 14.114 99
cluster_6.pdb ( medoid) 13.1371 4.49109 14.7074 59
cluster_7.pdb ( medoid) 12.8275 5.92479 29.2445 76
cluster_8.pdb ( medoid) 12.1604 4.76957 10.7818 58
cluster_9.pdb ( medoid) 12.0507 9.70896 23.2801 117
cluster_10.pdb ( medoid) 4.56288 15.3412 37.664 70
Laboratory of Theory of Biopolymers 2015