Project name: 2fmf bound default A QDQVDDLLDSLGF ss: CHHHHHHHHHHCC

Status: done

submitted: 2015-02-19 18:28:26, status changed: 2015-03-13 11:30:38

Project settings
Protein sequence(s) ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM input pdb
Peptide sequence QDQVDDLLDSLGF
Simulation mc cycles50
Peptide secondary structure CHHHHHHHHHHCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 34.8555 3.84444 32.1213 134
cluster_2.pdb ( medoid) 31.5592 2.28143 5.63116 72
cluster_3.pdb ( medoid) 28.466 3.58322 8.31193 102
cluster_4.pdb ( medoid) 27.8303 9.91726 35.2648 276
cluster_5.pdb ( medoid) 22.0199 5.63126 30.1225 124
cluster_6.pdb ( medoid) 20.1201 2.93239 22.6317 59
cluster_7.pdb ( medoid) 10.7647 5.94538 17.0374 64
cluster_8.pdb ( medoid) 10.6041 7.16703 17.6958 76
cluster_9.pdb ( medoid) 3.85267 10.1228 30.2683 39
cluster_10.pdb ( medoid) 3.09646 17.4393 36.5865 54
Laboratory of Theory of Biopolymers 2015