Project name: f6ab6a74f195346

Status: done

submitted: 2018-07-11 00:48:47, status changed: 2018-07-24 10:27:39

Project settings
Protein sequence(s) PDLVLNAEMVQQTTYLEDRPMFLLQCAMEENCLSASAAQTDPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLEDTECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEH input pdb
Peptide sequence PRSFLVRKPSDPNRKP
Simulation mc cycles50
Peptide secondary structure psipred CCCEEEECCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.07 5.2544 24.9415 158
cluster_2.pdb ( medoid) 19.679 5.43728 36.2091 107
cluster_3.pdb ( medoid) 19.1991 4.94816 28.8036 95
cluster_4.pdb ( medoid) 17.8323 5.27134 14.4461 94
cluster_5.pdb ( medoid) 17.6757 8.25995 37.7861 146
cluster_6.pdb ( medoid) 13.0265 8.82817 40.8572 115
cluster_7.pdb ( medoid) 7.31229 8.06861 21.8213 59
cluster_8.pdb ( medoid) 5.67556 14.4479 43.1615 82
cluster_9.pdb ( medoid) 5.43376 14.5387 41.0301 79
cluster_10.pdb ( medoid) 4.11135 15.8099 39.8158 65

 
Laboratory of Theory of Biopolymers 2015