Project name: H31E5OK6A02 4uq3

Status: done

submitted: 2017-12-07 04:15:54, status changed: 2017-12-08 04:11:11

Project settings
Protein sequence(s) GSSHSMRYFFTSVSRPGRGEPRFIAVVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEMIQRTPKIQVYSRHPAENGKSSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM input pdb
Peptide sequence VYATLLLLI
Simulation mc cycles200
Peptide secondary structure psipred CEEEEEEEC
Flexible regions
Unlikely to bind regions
1:D - 100:D 179:C - 275:C
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 50.6199 3.2991 23.4304 167
cluster_2.pdb ( medoid) 46.7417 2.24639 6.77511 105
cluster_3.pdb ( medoid) 43.0303 3.1838 31.07 137
cluster_4.pdb ( medoid) 30.6838 5.47519 42.6426 168
cluster_5.pdb ( medoid) 29.0001 3.65516 26.657 106
cluster_6.pdb ( medoid) 15.6515 4.40853 24.8798 69
cluster_7.pdb ( medoid) 14.1055 5.9551 34.4348 84
cluster_8.pdb ( medoid) 12.8835 5.7438 40.145 74
cluster_9.pdb ( medoid) 7.17704 10.032 29.5213 72
cluster_10.pdb ( medoid) 0.735334 24.4787 50.4659 18

 
Laboratory of Theory of Biopolymers 2015