Project name: fd716e8cba6848

Status: done

submitted: 2018-07-07 09:23:52, status changed: 2018-07-22 20:22:33

Project settings
Protein sequence(s) MAPGGYVAPKAVWLPAVKAKGLEISSGTFTHRQGHIYMEEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVVSQYIYQVYDSILKNSFGDGFADFGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDDIPNENELQFQIKECHLNADTVSSSKLQNNNVYTIAKRNVEGQDMLLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN input pdb
Peptide sequence MADDPYAGVSAQ
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.2817 3.79076 28.859 111
cluster_2.pdb ( medoid) 20.6295 4.45964 31.7157 92
cluster_3.pdb ( medoid) 19.5746 5.36409 32.7099 105
cluster_4.pdb ( medoid) 15.4596 3.75171 8.09381 58
cluster_5.pdb ( medoid) 14.4397 12.1886 32.4651 176
cluster_6.pdb ( medoid) 9.14631 4.26402 24.3897 39
cluster_7.pdb ( medoid) 7.96823 13.9303 46.2624 111
cluster_8.pdb ( medoid) 5.06153 17.1885 48.3643 87
cluster_9.pdb ( medoid) 2.05309 20.944 45.8421 43
cluster_10.pdb ( medoid) 0.845091 27.216 50.7362 23

 
Laboratory of Theory of Biopolymers 2015