Download models Download trajectory View trajectory
Status: Done started: 2017-Apr-11 14:42:54 UTC
Project Nameshubh
SequenceMATTTLNDSVTTTLASEPQRTYQVVVAATKEMGIGKDGKLPWNLPTDLKFFKDITLTTSDSSKKNAVVMGRKTWESIPIK YRPLSGRLNVVLTRSGGFDIANTENVVTCSSVDSALDLLAAPPYCLSIERVFVIGGGDILREALNRPSCDAIHLTEIDTS VDCDTFIPAIDTSVYQPWSSSFPVTENGLRFCFTTFVRVKSSADESSDESNGSQSLQFDGKKFLFLPKMVFDQHEEFLYL NMVEDIISNGNVKNDRTGTGTLSKFGCQMKFNLRRSFPLLTTKRVFWRGVVEELLWFISGSTNAKVLQEKGIHIWDGNAS REYLDGIGLTEREEGDLGPVYGFQWRHFGAKYTDMHADYTGQGFDQLVDVIDKIKNNPDDRRIIMSAWNPSDLKLMALPP CHMFAQFYVAEGELSCQMYQRSADMGLGVPFNIASYSLLTCMLAHVCDLVPGDFIHVLGDAHVYKTHVRPLQEQLLNLPK PFPVMKINPEKKQIDSFVASDFDLTGYDPHKKIEMKMAV
Secondary structure

CCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCCCCC CCCCCCCCEEEECCCCCCCCCCCCCEEEECCHHHHHHHHCCCCCCCCCCEEEEECCHHHHHHHHCCCCCCEEEEEEECCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHCCCCEECCCCCC HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCC CEEEEEEEEECCEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEECCCHHCCCCCHHHHHHHHCCCC CCCCEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCCCC

Simulation (CABS) temperature2.0 - 1.0
Estimated finish time2017-Apr-12 04:37 UTC

Time evolution of structural features: CABS energy, End-to-end distance and Radius of gyration.

Cluster #1234
Cluster density15.05.75.32.4
Cluster size1181069838
Average cluster RMSD7.918.618.415.7

Clustering of protein models is the task of separating a set of protein models (here a protein dynamics trajectory) into groups (called clusters). The clustering is done in such a way that models are more similar in the same group to each other (here in the sense of RMSD measure), than those in other groups (clusters). CABSfold utilizes classical K-means clustering method.
After clustering is done, each cluster representative is chosen (always the model which average dissimilarity to all models in a cluster is minimal). Predicted protein models, presented in the Predicted structures tab, are each cluster representatives (the clusters and the corresponding models are marked by the same numbers, e.g. Model 1 represents Cluster 1).
The clusters are numbered/ranked according to cluster density values, from the most dense (numbered as a first) to the least dense one.

#1234
1 0.00 10.80 9.80 39.80
2 10.80 0.00 33.50 49.40
3 9.80 33.50 0.00 52.60
4 39.80 49.40 52.60 0.00

The table contains RMSD values (calculated on the Cα atoms) between the predicted models.
Read more about the root-mean-square deviation (RMSD) measure.

#1234
1 1.00 0.06 0.05 0.06
2 0.06 1.00 0.06 0.06
3 0.05 0.06 1.00 0.06
4 0.06 0.06 0.06 1.00

The table contains GDT_TS values (calculated on the Cα atoms) between the predicted models.
Read more about the global distance test (GDT, also written as GDT_TS to represent "total score") measure.


 

© Laboratory of Theory of Biopolymers 2013