Download models Download trajectory View trajectory
Status: Done started: 2015-Mar-11 08:49:46 UTC
Project NameCYP51G1-De-novo
SequenceMELGDNKILNVGLLLVATLLVAKLISALIMPRSKKRLPPVVKAWPIVGGLIRFLKGPVVMLRQEYPKLGSVFTLNLLNKN ITFFIGPEVSAHFFKAPETDLSQQEVYQFNVPTFGPGVVFDVDYTIRQEQFRFFTEALRVTKLKGYVDQMVTEAEEYFSK WGESGEVDLKYELEHLIILTASRCLLGEEVRNKLFDDVSALFHDLDNGMLPISVIFPYLPIPAHRRRDNARKKLAEIFAN IINSRKRTGKAENDMLQCFIDSKYKDGRPTTEGEITGLLIAALFAGQHTSSITSTWTGSYLLTNDKYMSAVVDEQKNLMK KHGNKVDHDILSEMEVLYRCIKEALRLHPPLIMLLRSSHSEFSVTTREGKEYDIPKGHIVATSPAFANRLPHIFKNPDTY DPDRFGPGREEDKAAGAFSYISFGGGRHGCLGEPFAYLQIKAIWSHLLRNFEFELISPFPEIDWNAMVVGVKGEVMVKYK RRKLSVE
Secondary structure

CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHCCCEEEEEECCCC EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCHHHHHHCHHHHHHHHHHHHHH CCCCCEEEHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH HHHHHHHCCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHH HCCCCCCHHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHCCCCEEECCCCCCEECCCCCEEEECHHHHCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCEEECCCCCCCCCCCCCCCCCCCCCEEEEE ECCCCCC

Simulation (CABS) temperature3.5 - 1.0
Estimated finish time2015-Mar-11 21:44 UTC

Time evolution of structural features: CABS energy, End-to-end distance and Radius of gyration.

Cluster #1234
Cluster density15.82.10.80.7
Cluster size278511813
Average cluster RMSD17.623.921.619.9

Clustering of protein models is the task of separating a set of protein models (here a protein dynamics trajectory) into groups (called clusters). The clustering is done in such a way that models are more similar in the same group to each other (here in the sense of RMSD measure), than those in other groups (clusters). CABSfold utilizes classical K-means clustering method.
After clustering is done, each cluster representative is chosen (always the model which average dissimilarity to all models in a cluster is minimal). Predicted protein models, presented in the Predicted structures tab, are each cluster representatives (the clusters and the corresponding models are marked by the same numbers, e.g. Model 1 represents Cluster 1).
The clusters are numbered/ranked according to cluster density values, from the most dense (numbered as a first) to the least dense one.

#1234
1 0.00 37.00 53.50 5.28
2 37.00 0.00 46.40 60.80
3 53.50 46.40 0.00 37.70
4 5.28 60.80 37.70 0.00

The table contains RMSD values (calculated on the Cα atoms) between the predicted models.
Read more about the root-mean-square deviation (RMSD) measure.

#1234
1 1.00 0.07 0.05 0.05
2 0.07 1.00 0.05 0.05
3 0.05 0.05 1.00 0.04
4 0.05 0.05 0.04 1.00

The table contains GDT_TS values (calculated on the Cα atoms) between the predicted models.
Read more about the global distance test (GDT, also written as GDT_TS to represent "total score") measure.


 

© Laboratory of Theory of Biopolymers 2013