Download models Download trajectory View trajectory
Status: Done started: 2018-Mar-13 16:59:17 UTC
Project Nameth97
SequenceDMGCVVSWTGKELKCGSGIFVTDNVHTWTEQYQFQPESPARLASAILNAHKDGVCGIRSTTRLENVMWKQITNELNYVLW EGGHDLTVVAGDVKGVLVKGKRALTPPVNDLKYSWKTWGKAKIFTPEAKNSTFLIDGPDTSECPNERRAWNFLEVEDYGF GMFTTSIWMKFREGSSEVCDHRLMSAAIKDQKAVHADMGYWIESSKNQTWQIEKASLIEVKTCLWPKTHTLWSNGVLESQ MLIPKAYAGPFSQHNYRQGYATQTMGPWHLGKLEIDFGECPGTTVTIQEDCDHRGPSLRTTTASGKLVTQWCCRSCTMPP LRFLGEDGCWYGMEIRPLSEREENMVKSQVSA
Secondary structure

CCCEEEEECCCEEEECCCEEEECCCCCCCEECCCCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCEEEE CCCEEEEEEECCEEEEECCCCCCCCCCCCCCCCCHHCCCCEEEECCCCCCCEEEEECCCCCCCCCCCCCCEEEEEEEEEE EEEEEEEEEEECCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCEEEEEEEEEEEEEECCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCEEEEECCCCCCCCCCCEEEECCCCEEEEEECCCCCCCC CEECCCCCEEECCEECCCCHHHHHHHHHHHCC

Simulation (CABS) temperature2.0 - 1.0
Estimated finish time2018-Mar-14 05:54 UTC

Provided templates.

Time evolution of structural features: CABS energy, End-to-end distance and Radius of gyration.

Cluster #1234
Cluster density79.626.111.67.9
Cluster size197913339
Average cluster RMSD2.53.52.85.0

Clustering of protein models is the task of separating a set of protein models (here a protein dynamics trajectory) into groups (called clusters). The clustering is done in such a way that models are more similar in the same group to each other (here in the sense of RMSD measure), than those in other groups (clusters). CABSfold utilizes classical K-means clustering method.
After clustering is done, each cluster representative is chosen (always the model which average dissimilarity to all models in a cluster is minimal). Predicted protein models, presented in the Predicted structures tab, are each cluster representatives (the clusters and the corresponding models are marked by the same numbers, e.g. Model 1 represents Cluster 1).
The clusters are numbered/ranked according to cluster density values, from the most dense (numbered as a first) to the least dense one.

#1234
1 0.00 9.39 11.60 10.50
2 9.39 0.00 5.01 8.75
3 11.60 5.01 0.00 9.07
4 10.50 8.75 9.07 0.00

The table contains RMSD values (calculated on the Cα atoms) between the predicted models.
Read more about the root-mean-square deviation (RMSD) measure.

#1234
1 1.00 0.79 0.74 0.79
2 0.79 1.00 0.76 0.80
3 0.74 0.76 1.00 0.76
4 0.79 0.80 0.76 1.00

The table contains GDT_TS values (calculated on the Cα atoms) between the predicted models.
Read more about the global distance test (GDT, also written as GDT_TS to represent "total score") measure.


 

© Laboratory of Theory of Biopolymers 2013