Project name: test6

Chain sequence(s)	A: GGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFREN
Distance of aggregation	5 Å
Dynamic mode	No

• Minimal score value: -2.4378
• Maximal score value: 2.3648
• Average score: -0.4347
• Total score value: -34.344

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	G	A	-0.5546
2	G	A	-0.5947
3	S	A	0.0314
4	V	A	1.5075
5	Q	A	-0.4878
6	I	A	2.1176
7	V	A	2.3648
8	Y	A	1.2041
9	K	A	-1.5228
10	P	A	-0.1806
11	V	A	1.4018
12	D	A	-1.1658
13	L	A	1.1683
14	S	A	-0.2453
15	K	A	-1.4952
16	V	A	0.9621
17	T	A	0.1346
18	S	A	-0.5300
19	K	A	-1.6007
20	C	A	0.3278
21	G	A	-0.3691
22	S	A	-0.0121
23	L	A	1.4217
24	G	A	-0.4194
25	N	A	-1.1591
26	I	A	0.6351
27	H	A	-0.9557
28	H	A	-1.4039
29	K	A	-1.9163
30	P	A	-0.6589
31	G	A	-0.5994
32	G	A	-0.6365
33	G	A	-0.7613
34	Q	A	-1.0782
35	V	A	0.5288
36	E	A	-1.4314
37	V	A	0.3230
38	K	A	-1.5550
39	S	A	-0.8626
40	E	A	-2.1769
41	K	A	-1.7464
42	L	A	0.8876
43	D	A	-1.1504
44	F	A	1.1749
45	K	A	-1.6841
46	D	A	-2.4378
47	R	A	-1.9989
48	V	A	0.3456
49	Q	A	-1.0495
50	S	A	-0.6587
51	K	A	-1.4715
52	I	A	0.9109
53	G	A	-0.2194
54	S	A	-0.0063
55	L	A	1.1759
56	D	A	-1.7409
57	N	A	-1.2336
58	I	A	1.7617
59	T	A	0.1187
60	H	A	-0.8814
61	V	A	0.4271
62	P	A	-0.1055
63	G	A	-0.5810
64	G	A	-0.6415
65	G	A	-0.6945
66	N	A	-1.1756
67	K	A	-2.1679
68	K	A	-1.6438
69	I	A	1.3547
70	E	A	-1.4586
71	T	A	-0.5962
72	H	A	-1.3241
73	K	A	-1.6978
74	L	A	0.6820
75	T	A	0.3912
76	F	A	0.9899
77	R	A	-1.9325
78	E	A	-2.4067
79	N	A	-1.6149