Project name: SH3_S134F

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134F
Energy difference between WT (input) and mutated protein (by FoldX)	-1.09231 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4735
• Maximal score value: 1.2494
• Average score: -0.8508
• Total score value: -51.0455

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4503
82	S	A	-0.6820
83	H	A	-0.7912
84	M	A	0.2693
85	T	A	0.0000
86	F	A	-0.0865
87	V	A	-0.6010
88	A	A	0.0000
89	L	A	-0.2640
90	Y	A	-0.6724
91	D	A	-2.8196
92	Y	A	-2.0857
93	E	A	-2.8812
94	S	A	0.0000
95	R	A	-2.7834
96	T	A	-2.1532
97	E	A	-2.3518
98	T	A	-1.2397
99	D	A	-1.3247
100	L	A	0.0000
101	S	A	-1.9027
102	F	A	0.0000
103	K	A	-3.4735
104	K	A	-2.8326
105	G	A	-1.9537
106	E	A	0.0000
107	R	A	-2.0687
108	L	A	0.0000
109	Q	A	-0.2440
110	I	A	0.5124
111	V	A	1.2494
112	N	A	-0.4209
113	N	A	-1.7253
114	T	A	-1.7348
115	E	A	-2.8588
116	G	A	-2.4722
117	D	A	-2.4779
118	W	A	-1.1257
119	W	A	-0.5361
120	L	A	0.4775
121	A	A	0.0000
122	H	A	-0.3845
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4117
129	T	A	-0.4933
130	G	A	0.0000
131	Y	A	0.3024
132	I	A	0.0000
133	P	A	-0.2080
134	F	A	-0.5976	mutated: SA134F
135	N	A	-0.8819
136	Y	A	0.1049
137	V	A	0.0000
138	A	A	0.1037
139	P	A	-0.1466
140	S	A	-0.1731