Project name: SH3_S94I

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA94I
Energy difference between WT (input) and mutated protein (by FoldX)	3.83008 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4796
• Maximal score value: 1.2504
• Average score: -0.9046
• Total score value: -54.2769

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1045
87	V	A	-0.6253
88	A	A	0.0000
89	L	A	-0.3221
90	Y	A	-0.7556
91	D	A	-2.8510
92	Y	A	-1.9992
93	E	A	-2.6946
94	I	A	-1.8096	mutated: SA94I
95	R	A	-2.6063
96	T	A	-2.0255
97	E	A	-2.2735
98	T	A	-1.1526
99	D	A	-1.1381
100	L	A	0.0000
101	S	A	-1.7394
102	F	A	0.0000
103	K	A	-3.4796
104	K	A	-2.8686
105	G	A	-1.9662
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4377
111	V	A	1.2504
112	N	A	-0.4182
113	N	A	-1.8121
114	T	A	-1.7316
115	E	A	-2.9341
116	G	A	-2.6064
117	D	A	-2.6802
118	W	A	-1.3245
119	W	A	-0.6841
120	L	A	0.4201
121	A	A	0.0000
122	H	A	-0.3833
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8751
127	G	A	-0.8169
128	Q	A	-1.4000
129	T	A	-0.4772
130	G	A	0.0000
131	Y	A	0.3011
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2842
135	N	A	-1.2513
136	Y	A	-0.2087
137	V	A	0.0000
138	A	A	-0.0218
139	P	A	-0.1505
140	S	A	-0.1759