Project name: CH2 A3D

Status: done

submitted: 2018-11-18 10:18:50, status changed: 2018-11-18 10:23:11
Settings
Chain sequence(s) A: GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTTVLLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.5601
Maximal score value
1.8292
Average score
-1.0512
Total score value
-112.479

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
236 G A -0.8043
237 G A -0.8531
238 P A 0.0000
239 S A -0.2533
240 V A 0.0000
241 F A 1.1104
242 L A 0.0000
243 F A 1.0750
244 P A -0.5959
245 P A 0.0000
246 K A -2.3527
247 P A -1.5842
248 K A -1.6832
249 D A 0.0000
250 T A 0.0000
251 L A 1.0917
252 M A 1.1481
253 I A 1.8292
254 S A 0.2785
255 R A -1.3344
256 T A -0.7310
257 P A 0.0000
258 E A -0.9992
259 V A 0.0000
260 T A 0.3228
261 C A 0.0000
262 V A 0.0000
263 V A 0.0000
264 V A -0.4893
265 D A -1.4950
266 V A 0.0000
267 S A -2.1486
268 H A -2.2440
269 E A -2.8771
270 D A -2.6255
271 P A -2.4475
272 E A -3.0494
273 V A -1.9472
274 K A -2.2471
275 F A -1.2838
276 N A -1.4551
277 W A 0.0000
278 Y A -0.9805
279 V A -1.0693
280 D A -2.1512
281 G A -1.0115
282 V A 0.2680
283 E A -1.3198
284 V A -0.7016
285 H A -1.7742
286 N A -1.6726
287 A A -1.5982
288 K A -2.3104
289 T A -1.9864
290 K A -2.6106
291 P A -2.4444
292 R A -3.4044
293 E A -3.5601
294 E A -3.0305
295 Q A -1.6852
296 Y A 0.1405
297 N A -0.7855
298 S A -1.1881
299 T A -1.8562
300 Y A -2.3893
301 R A -2.3496
302 V A 0.0000
303 V A 0.0000
304 S A 0.0000
305 V A -0.7611
306 L A 0.0000
307 T A -0.4621
308 V A 0.0000
309 L A 1.0261
310 H A 0.5131
311 Q A -0.5174
312 D A -1.3162
313 W A 0.0000
314 L A -0.5416
315 N A -1.8789
316 G A -2.3802
317 K A -2.4488
318 E A -2.8381
319 Y A 0.0000
320 K A -1.8034
321 C A 0.0000
322 K A -1.7472
323 V A 0.0000
324 S A -1.5104
325 N A 0.0000
326 K A -2.5644
327 A A -1.4103
328 L A -0.6456
329 P A -0.4383
330 A A -0.4354
331 P A -0.9743
332 I A -0.6638
333 E A -1.9986
334 K A -1.3795
335 T A -1.5778
336 I A 0.0000
337 S A -2.4882
338 K A -2.8639
339 A A -2.0076
340 K A -2.6838
341 G A -2.0707
342 Q A -1.4943

 

Laboratory of Theory of Biopolymers 2015