Project name: 2mz7

Chain sequence(s)	A: KHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKP
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -3.1672
• Maximal score value: 1.5594
• Average score: -0.6764
• Total score value: -31.1137

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
267	K	A	-3.0445
268	H	A	-3.0747
269	Q	A	-2.2430
270	P	A	-1.4882
271	G	A	-1.4610
272	G	A	-1.4776
273	G	A	-1.9168
274	K	A	-1.7735
275	V	A	0.0396
276	Q	A	-0.6617
277	I	A	0.9720
278	I	A	1.3295
279	N	A	-0.2096
280	K	A	-1.2031
281	K	A	-0.9961
282	L	A	0.7141
283	D	A	-0.0958
284	L	A	0.9203
285	S	A	-0.7219
286	N	A	-1.0743
287	V	A	0.8586
288	Q	A	-0.1189
289	S	A	-0.9422
290	K	A	-1.8400
291	C	A	-0.3002
292	G	A	-0.6565
293	S	A	-0.9319
294	K	A	-2.5623
295	D	A	-3.1672
296	N	A	-2.0459
297	I	A	-0.6554
298	K	A	-2.4478
299	H	A	-0.9883
300	V	A	0.0000
301	P	A	-0.2096
302	G	A	0.4496
303	G	A	-0.2364
304	G	A	-0.9635
305	S	A	-0.2718
306	V	A	1.4864
307	Q	A	0.1324
308	I	A	0.7580
309	V	A	1.5594
310	Y	A	1.1560
311	K	A	-1.1251
312	P	A	-0.5848