Project name: SH3_E115C

Status: done

submitted: 2019-03-14 15:28:19, status changed: 2019-03-14 17:27:54
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues EA115C
Energy difference between WT (input) and mutated protein (by FoldX) 0.409383 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.2597
Average score
-0.7454
Total score value
-44.7248

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1549
97 E A -2.3535
98 T A -1.2430
99 D A -1.3267
100 L A 0.0000
101 S A -1.9045
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2463
110 I A 0.4428
111 V A 1.2597
112 N A 0.0382
113 N A -0.9477
114 T A -0.4942
115 C A -0.3908 mutated: EA115C
116 G A -1.3701
117 D A -1.9589
118 W A -0.6509
119 W A -0.0835
120 L A 0.7197
121 A A 0.0000
122 H A -0.3823
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.4959
130 G A 0.0000
131 Y A 0.2137
132 I A 0.0000
133 P A 0.0000
134 S A -0.9908
135 N A -1.2496
136 Y A -0.2047
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015