Project name: SH3_E115V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	EA115V
Energy difference between WT (input) and mutated protein (by FoldX)	1.12874 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2586
• Average score: -0.6776
• Total score value: -40.6582

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1555
97	E	A	-2.3540
98	T	A	-1.2445
99	D	A	-1.3177
100	L	A	0.0000
101	S	A	-1.9052
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2465
110	I	A	0.4417
111	V	A	1.2586
112	N	A	0.2307
113	N	A	-0.5755
114	T	A	0.0274
115	V	A	0.6840	mutated: EA115V
116	G	A	-0.8327
117	D	A	-1.6119
118	W	A	-0.2690
119	W	A	0.2137
120	L	A	0.8650
121	A	A	0.0000
122	H	A	-0.3834
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4973
130	G	A	0.0000
131	Y	A	0.2343
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-0.8384
135	N	A	-1.2364
136	Y	A	-0.1949
137	V	A	0.0000
138	A	A	-0.0213
139	P	A	-0.1505
140	S	A	-0.1759