Project name: SH3_V111G

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	VA111G
Energy difference between WT (input) and mutated protein (by FoldX)	1.4481 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 0.2579
• Average score: -1.0242
• Total score value: -61.4532

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.7302
82	S	A	-0.6895
83	H	A	-0.7962
84	M	A	0.2579
85	T	A	0.0000
86	F	A	-0.1158
87	V	A	-0.6282
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1605
97	E	A	-2.3591
98	T	A	-1.2384
99	D	A	-1.3254
100	L	A	0.0000
101	S	A	-1.9118
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0887
108	L	A	0.0000
109	Q	A	-0.8891
110	I	A	-0.6142
111	G	A	-0.9019	mutated: VA111G
112	N	A	-1.3272
113	N	A	-2.2280
114	T	A	-1.9296
115	E	A	-2.8925
116	G	A	-2.5934
117	D	A	-2.6907
118	W	A	-1.3062
119	W	A	-1.0468
120	L	A	-0.1825
121	A	A	0.0000
122	H	A	-0.9472
123	S	A	0.0000
124	L	A	-0.3021
125	T	A	-0.7874
126	T	A	-0.8872
127	G	A	-0.8328
128	Q	A	-1.4310
129	T	A	-0.7898
130	G	A	0.0000
131	Y	A	-0.0269
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2759
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1552
140	S	A	-0.1759